PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA97G00029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 245aa    MW: 28467 Da    PI: 9.1364
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA97G00029genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed  lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
       AA97G00029 10 KGPWTEQEDMVLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding54.33e-1763108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
       AA97G00029  63 RGKMTSQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 108
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.36557IPR017930Myb domain
SuperFamilySSF466895.03E-308104IPR009057Homeodomain-like
SMARTSM007173.4E-15959IPR001005SANT/Myb domain
PfamPF002499.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-211164IPR009057Homeodomain-like
CDDcd001676.08E-111257No hitNo description
PROSITE profilePS5129426.96258112IPR017930Myb domain
SMARTSM007171.9E-1662110IPR001005SANT/Myb domain
PfamPF002492.2E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2365111IPR009057Homeodomain-like
CDDcd001671.35E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MKIMQEDFRK GPWTEQEDMV LVNFVHLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGKMTSQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK KAQEKKRPIS  120
RTSSSSNCCS SSMTTATTQE TSPRFEKESF YDTGGSYGKM NQEEGYSMDD IWREIDQSGG  180
NLMKPVRDIY SEQSCYLNCP SMASPAWESS LESIWNMDAY ESKISSFGFD QFPVSFGHSR  240
SSLAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-29211250159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-29211250159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010443755.11e-138PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ4JL841e-131MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A078JWX01e-133A0A078JWX0_BRANA; BnaAnng32620D protein
TrEMBLM4DUU61e-133M4DUU6_BRARP; Uncharacterized protein
STRINGBra020289.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-128myb domain protein 59